SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000011066 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000011066
Domain Number 1 Region: 834-1046
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-44
Family DBL homology domain (DH-domain) 0.00049
Further Details:      
 
Domain Number 2 Region: 1209-1395
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-27
Family Pleckstrin-homology domain (PH domain) 0.0000185
Further Details:      
 
Domain Number 3 Region: 1035-1152
Classification Level Classification E-value
Superfamily PH domain-like 8.05e-24
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000011066
Sequence length 1399
Comment (Cavia porcellus)
Sequence
VSSCALIKKPPVAPKPKFVVANNKPAPPAIAPKPDSVVASTPQSTKKTKPAIAPKPKVLK
SSPVEELSPSLLRRTGTQEEQKPGAPQSTDSFNCISIGDQKNMSVKQLVLEPLEMKENLE
NSKMDKSSLMIKTQMKWNSGEKCRSQSGVILKASILEAKLKDALRQQMSAFGYPQKHISA
GSLEINGGGSTIEGFGVDLPDASPCPSSFEKVPVSPNCHLQHPRGEFQNLETYKEGSKKS
NNYFDSSEPEALGNDKKDMFIPSGEVSKNTKVKDLSPVAVDSVTGSPKFPTPKPRRTRLL
RQKHVDSPSESAAEPEDDSNSCSCPGEVSLKNSEVSVLGENVLCHQDSVNKVTPGDKSEL
NGSSSGDRQDLCHGTSSLENTAPSLDTDSNLSSDSRADVDGPNTSHDADRGTYFTKSNTL
SWSLPKQLTLTCSDHLPAGNLGMSAPSVQKGCMVKQASSSRTVPKKPQRHSLPATGVLKK
AASVELVEKSSYPSAEIKSSGEVLEGNHLQHFCTPGQAVSSSCFDMPKRTSEKPVWKLPH
PILPFLGNSESLKFVTVSSSSDASVALPKPRAKSMSSVDLDRCTKPCKHSPKKNSFRQLF
NRKLSMCFMKGDFPKLRSRSSQAGDTNRASLWAGGRGGLGGDWSGLMVADLERRGKPSKA
YSADHYSPERSWGGTGVANGPKAESLDDQVLSREPSSLEPGKGVTSVCAPEYENVRHYEE
IPEYENLPFVTAAGKTLELEGWNSSSTEDTDANVYEVEEPCEAAGDQLPRGPGYPCSSSS
GPAPGEPRDPDLSLVDPPSDEDEVINSSDEEDGGSGSSKGEPEPLEEKQEEGTGVKSKVH
HIAEEIMSSEKVFVDVLKLLHIDFRDAVAHASRQLGKPVIEDRVLNQILYYLPQLYELNR
DLLSELEERMSNWTEQQRIADIFVKKGPYLKMYSTYIKEFDKNIALLDEQCKKVPGHQNV
VGSLFQMSPRCANLALKHYLLKLVQRIPQYRLLLTVDYLKNLLEDSADYRDTQDALAVVI
EVANHANDSMKQGDNFQKVLRIQYSLSGHREILQPGRVFLKEGVLMKLSRKVMQPRMFFL
FNDVLLYTTPLQSGTYKLNNILSLAAMKVRKPSQEAYQNELKIESVERSFILSASSAQER
DEWLAAITGAIEDHAKKRVTFCPGRSLDEADSERKEEVTPLGSKAPIWVPDTRATMCMIC
TREFTLTWRRHHCRACGKVVCQACSSNKHGLDYLKNQPARVCEHCFQELQKLDHQHSPRP
RPAVSHKSPSSALTSVLQSIPSGRKQKKIPAALKEVRASAEDSTMSGYLHRAKGARKPWR
HLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTRVSDDSADPRVFQLLHKDMVFYVFKA
EDAQSAQKWMEAFQEGTVL
Download sequence
Identical sequences 10141.ENSCPOP00000011066 ENSCPOP00000011066 ENSCPOP00000011066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]