SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000011557 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000011557
Domain Number 1 Region: 215-454
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.43e-74
Family Eukaryotic proteases 0.000000137
Further Details:      
 
Domain Number 2 Region: 42-99
Classification Level Classification E-value
Superfamily GLA-domain 5.55e-21
Family GLA-domain 0.00035
Further Details:      
 
Domain Number 3 Region: 136-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000385
Family EGF-type module 0.001
Further Details:      
 
Domain Number 4 Region: 98-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000782
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000011557
Sequence length 465
Comment (Cavia porcellus)
Sequence
MWRLAGLLLFLAIWGISGKPVPSDSVFSSSQRAHQVLRIRKRANAFLEEVRPGNLERECY
EEICDFEEAKEIFQTVDATLAFWSTYFDGDQCANLPPEHQCASPCCEHGVCIDGLGSFTC
ACKAGWEGRFCQNEVSYSNCSVNNGGCAHYCLVEGDARRCSCAPDYKLADDHLQCEPVVI
FPCGRIQMQVEKKRSNYKRDTNQVEQENQDEPLDPRMINSTESTWQVILLDSKKKLSCGG
VLIHSSWVLTAAHCMDGSRKLTVRLGSGCSEYDLRRRDKGEVELDIKEIFIHPNYTRRTT
NNDIALLHLAQPTILSKTIVPICLPDSGLAERELTQAGQETVVTGWGYKSERKGDTRRNP
TSILNSIRIPVAPHTECTQVMNSVVSENMLCAGILGDSRDACDGDSGGPMVASFQGTWFL
VGLVSWGEGCGVPNNYGVYTKVSRYLDWINSHITGKGGVPRNHVL
Download sequence
Identical sequences ENSCPOP00000011557 ENSCPOP00000011557 10141.ENSCPOP00000011557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]