SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000011844 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000011844
Domain Number 1 Region: 1176-1378
Classification Level Classification E-value
Superfamily PH domain-like 7.79e-32
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 829-1020
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-26
Family DBL homology domain (DH-domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 1007-1125
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-23
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000011844
Sequence length 1380
Comment (Cavia porcellus)
Sequence
ADSPKPPVAPKPKTTAFKFPASPRAEGPHSPSPMSRGPKPPLAPKPRLAGPAGCRPGAHV
NHQLFKCSNGQLPCGARDSPNPECSGSETDEDIFTGPWAAPEEDTAKDMGSAGEEACVDG
GIEEAGDTQDLILPAGEEGPEDEQEEEDGSHGSGTGELLPVGEEEEEPGGRPGPCDLEDS
QHEASWTHEVPREEPGLPGDTTEVEEDGEEGHCHSEPDSGQEVGKASEEPASFEEPECKE
PSCEDEETPELTPCAQESVPVPECFGSPQEQSMDIQPDQDEPSEPDGKDTQDGRGPGAAE
DLMPTEPPEESCQIIPFESSSVEDLVVALEGSAYELFPSESTSFCGDSCAPVMLAGSMES
EPGPKWDVPSTGTAGDKKAEAGAAPPVPNVVVLPEDEGTTDVACNDPCMTESKEDTACDT
EGGLVPGDKRNVVPWAWPHSGKVAGCVPETVPEESGPEAGSSAVGIAKEAGRPVLPLEAG
WALHPRSFSVEGREPPGVANREPQGTGLDLHRMKRKEDNLSLPCVIGSSGSFSQSKHLPS
SGTSTPCSLVDIPPPFDLACVTKRPVTKSFPSLLLDSEAPDKTTKKKKSSFKRFLALTFR
RKTDSKAHVDTGLASSRSSSESSYHGPCRLLDGDRRSLGSSPQLRAQVGKPRAPESPASL
LFSKDGRRRGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIPALSS
DYENIQLPPRRPARPGTFTKLFEEQSRALSAANENDGYVDMSSFSAFDSRVQSTEPEAES
AYTEPYKVCPISAMTPRENLGSEEEQSSSEEEDGTLRDPSITNKVEGPSRALVIAQELLS
SERVFLQTLGPVCLDFHAAVMRALDNVEDTAIHALHQGILQELEQRLGDGEGPSQVADIF
LAREQEFEHHAVLILHFDRSLALLAQTCTRCPHLAATIRDFEQQGGQRVKQQLLAVVRRP
FQYHVLLTDYLNNLCPDSAEYDNTQGALTLISTITDRAHDSMEQGENLQKLVHIEHSVSG
QGDLLQPGREFLKEGTLMKVRGKDRHPRHLFLMSDVLLYTHPQKDGKYRLKRSLPVAGMK
VSRPVMENVPYALRIETAQSCLTLSASSCAERDEWHSCLSRAVPEDHEAQALAAFHYSAE
LRERLGVSLGERPPTLVPVTHAVMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYPLK
YLRDRMAKVCDGCFGELRKRGGTPPATLRERPVTMSFPLSSPRFSSGSALSSVFHSINPS
NFKKQKKVPSALAEVAASGEGLAISGYLSRCKRGKRPWKRLWFVIKGKVLYTYTAHEDKV
ATESIPLLGFTIAPGREEGNSDPSPVFHLYHKKTLFYSFKAEDTSAAQRWMEAMEDASVL
Download sequence
Identical sequences ENSCPOP00000011844 ENSCPOP00000011844 10141.ENSCPOP00000011844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]