SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000012215 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000012215
Domain Number 1 Region: 280-408
Classification Level Classification E-value
Superfamily ApaG-like 7.32e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily F-box domain 1.18e-18
Family F-box domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000012215
Sequence length 415
Comment (Cavia porcellus)
Sequence
MAAMEAESAMMTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARDPAAIDMFI
IGATFTDWFTSYVRNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRV
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLVS
Download sequence
Identical sequences H0VP13
ENSCPOP00000012215 ENSCPOP00000012215 10141.ENSCPOP00000012215 XP_003463892.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]