SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000012313 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000012313
Domain Number 1 Region: 14-133,320-644
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.44e-74
Family Integrin alpha N-terminal domain 0.0000863
Further Details:      
 
Domain Number 2 Region: 152-341
Classification Level Classification E-value
Superfamily vWA-like 3.41e-48
Family Integrin A (or I) domain 0.0000000263
Further Details:      
 
Domain Number 3 Region: 647-790
Classification Level Classification E-value
Superfamily Integrin domains 3.45e-32
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 4 Region: 793-919
Classification Level Classification E-value
Superfamily Integrin domains 3.45e-22
Family Integrin domains 0.0073
Further Details:      
 
Domain Number 5 Region: 925-1126
Classification Level Classification E-value
Superfamily Integrin domains 1.36e-17
Family Integrin domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000012313
Sequence length 1165
Comment (Cavia porcellus)
Sequence
VFLSKIVLGFCESFNVDVKNSMSFSGPVEDMFGYTVQQYANEEGKWVLIGSPLVGQPKTR
TGDVYKCPVGRGESLPCIKLDLPVNTSIPNVTEIKENMTFGSTLVTNPKGGFLACGPLYA
YRCGHLHYTTGICSDVSPTFQVVNSFAPVQECNTQLDIVIVLDGSNSIYPWASVTDFLND
LLEKMDIGPKQTQVGIVQYGQEVTHEFNLNKYSSTEEILVASQRGGRQTMTALGIDTARK
EAFTEARGARRGVKKVMVIVTDGESHDNHELKKVIQDCEDENIQRFSIAILGSYNRGNLS
TEKFVAEIKSIASKPTENHFFNVSDELALVTIVKALGERIFALEATVDQSAASFEMEMSQ
TGFSAHYSQDWVMLGAVGAYDWNGTVVMHKANQNIIPQNTTFQVGSTKMNEPLASYLGYT
VNSATASGDVLYVAGQPRYNHTGQVIIYRMEDGHIKILQAFHGEQIGSYFGSVLTTIDID
NDSNTDILLIGAPMYMGTEKEEQGKVYVYTLNQTKFEYQMSLEPIKQTCCASLKHNSCTK
ENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHAGAVYIYHGSGKTIRKEYAQR
IPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAALFWSRDVAVVEVSMNFEPNK
VNIQKKNCRVEGKETVCINATMCFDVKLRSKEDSIYEADLQYRVTLDSLRQISRSFFSGT
QERKIQRNITVRESKCVKHSFYMLDKHDFQDSVRVTVDFNLTDPENGPVLDDSLPNLVHE
YIPFAKDCGNKEKCISDLTLDVSTTEKGLFIVKSQNDKFNISITVKNKGDSAYNTRTIAQ
YSPNLIFSGIEGIQKDSCESNRNITCKVGYPFLRKGEMVTFKILFQFNTSYLMENLIIYL
STTSDSEEPSETLFDNAVNISIPVKYEVGLQFSSYASEYHISVASNETVPEAINSTEDIG
NEINIFYLIKKRGHFPMPELKLSISFPNLTSDGFPVLYPNGWSSSDNANCRPRSLEDPFG
INSGTKMSISKSELLKRGTFPDCKTCKFATITCNLLPSDVSQVNVSLILWKPTFIKTHFS
SLNLTIRGDLQSENSSLILSSSNQRRELAIQISKDGLPGRVPLWVILLSAFAGLLLLMLL
ILVLWKKDILRNYREFLEKHKKMKE
Download sequence
Identical sequences 10141.ENSCPOP00000012313 ENSCPOP00000012313 ENSCPOP00000012313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]