SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000012622 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000012622
Domain Number 1 Region: 321-603
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.76e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000105
Further Details:      
 
Domain Number 2 Region: 144-320
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.29e-53
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000807
Further Details:      
 
Domain Number 3 Region: 605-711
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.1e-28
Family Anticodon-binding domain of Class II aaRS 0.001
Further Details:      
 
Domain Number 4 Region: 82-142
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000262
Family TGS domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000012622
Sequence length 722
Comment (Cavia porcellus)
Sequence
LMSEKASAPVEKMGGEEKPVDAGKEKQKEGGKKNKEGSGDGGRAELNPWPEYINTRLEMY
NKLKAEHDSILAERAEKDSKPIKVTLPDGKQVDAESWRTTPYQIACGISQGLADNTVVAK
VNKIVWDLDRPLEEDCTLELLKFENEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIEN
GFYYDMYLEEGGVSSNDFSSLETLCKKIMKEKQAFERLEVKKETLLEMFKYNKFKCRILN
EKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKSLKIHKNSSTYWEGKADMETLQRIYGIS
FPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLMEFIR
SEYRKRGFQEVVTPNMYNSKLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFD
HRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEEEIKGCLN
FLHTVYNVFGFSFKLNLSTRPEKFLGDIEIWNQAEKQLENSLNEFGQKWELNPGDGAFYG
PKVDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGDDKKRPVMIHRAILGSVERMI
AILTENYGGKWPFWLSPCQVMVVPVGPTCDEYAQKVRQQFHDAKFMVDVDLDPGCTLNKK
IRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHGERTISETIERLQQLKQSHSRQAEE
EF
Download sequence
Identical sequences ENSCPOP00000012622 10141.ENSCPOP00000012622 ENSCPOP00000012622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]