SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000013414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000013414
Domain Number 1 Region: 1170-1336
Classification Level Classification E-value
Superfamily C-type lectin-like 5.96e-77
Family Endostatin 0.0000000474
Further Details:      
 
Domain Number 2 Region: 23-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.08e-35
Family Laminin G-like module 0.027
Further Details:      
 
Domain Number 3 Region: 820-979
Classification Level Classification E-value
Superfamily C-type lectin-like 2.89e-26
Family Endostatin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000013414
Sequence length 1342
Comment (Cavia porcellus)
Sequence
VISIILSASLETAVSADSTSQGHLDLTQLIGVPLPSSVSFVTGYGGFPAYSFEPGANVGR
PARTLIPPTFFRDFAISVLAKPSSPQGGVLFAITDAFQKVIHLGLRLSGVEDGHQRIILY
YTEPGSHVSHEAAVFSVPVMTNRWNHFTVIIQGEEVTLLVDCEEHSHVLFQRSSGPLAFG
PSTGIFVGSAGATGLDRFTGSIQQLIIHPDPRTPEELCEAQESSASGEASGLQETDTVAE
ILEAVSYTQAPPKEAKAEPINIPPTSSSPLEDTELSGEPVPEGTPETNLSISQNNSPEQG
SGEILNNTLERVHSEDGDTVADVGSGERTFLDATEEQGSAAIEAEEGEVATSTPQEAEVS
SMPATVLNLAVSTLNPQEGTTPGLEDEEGSAGEGTGKAEAPVTPAREAESGSIPTLGSAL
TMPTQIPREETTQGPGEEQLTTATAAPEVPLSTFGEEEASGASTDDLAILTPTVAPAHAS
RASTDDLDVLTSTVALGQMSGDMTAGRGRMQFPTQAPDDMEDLEPLATAGREGTSGAPPA
GLPLPVPTEAPERQVTLVGAETEGSGQEWGLDIGSASGDLVDREELLRPSPGPQGKPGLP
GIPGEPGTGVLMGPPGSPGKDGAAGEPGIPGPEGEPGLDGTAGRPGMKGEKGARGPNGSA
GEKGDPGNRGLPGPPGKNGQAGTPGVSPGCAAGLEFEDTEGSGSVRLSSEPRIPRPTVSS
GLKGEKGDQGPKGERGSDGVSTVGPPGPRGPPGRIEILSSSLINITHGSLNFSDIPELLG
PPGPDGLPGLPGFPGPRGPKGDTGSPGFPGLKGEQGEKGEPGAILTGDVPLERLKGRKGE
PGLHGAPGPMGPKGPPGHKGEFGLPGRPGRPGLNGLKGAKGDRGIMMPGPPGLPGPPGPP
GPPGAVVNIKGTVYPVPVRPHCKMPVGTTHPGDTELITFHGVKGEKGSWGLPGSKGEKGD
QGAQGPPGPPVDPVYLRHFLNSLKGENGDRGFKGEKGDSNDHFFVSGSPGLPGNPGLAGQ
KGESIIGPQGPPGIPGLPGPPGFGRPGVPVNHGFPGSSRRCLSFVLAVALPGPPGPPGQP
GIPGSRNLVTAFSSMDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGDLIPIPA
DSPPPPALSSNSYQLQPPLNPILSGNYENPALHLVALNMPFSGDIRADFQCFQQARAAGL
LSTFRAFLSSHLQDLSTVVRKAERYSLPIVNLKGQVLFNNWDSIFSGDGGQFNTHVPIYS
FDGRDVMTDPAWPQKVVWHGSTAHGVRLVDKYCAAWRTADTAVTGFASPLSTGKILDQRA
YSCADRLIVLCIENSFMTDARK
Download sequence
Identical sequences ENSCPOP00000013414 ENSCPOP00000013414 10141.ENSCPOP00000013414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]