SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000013568 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000013568
Domain Number 1 Region: 52-136,184-313,355-471,563-624,652-676
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.27e-32
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 
Domain Number 2 Region: 486-530
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000453
Family Ovomucoid domain III-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000013568
Sequence length 709
Comment (Cavia porcellus)
Sequence
VGCPTGPAGERPQMPNKDSNATMDTEDIPGGKSSPEPRNFGPRVFQSIKFFVLCHSLLQL
AQLMISGYLKSSISTVEKRFGLSSQTSGLLAAFNEVGNTALIVFVSYFGSRVHRPRMIGC
GAVLVALAGLLMSLPHFISEPYHFDHTSPEDVSQDFAASLCLPTASALAPDHSNGNCSSF
TEVRHVTVVGLMFLAQTLLGVGGVPIQPFGISYIDDFAHHSNSPLYLGILFAVTMMGPGM
AYGLGSLMLRLYVDIDRMPEGGVSLTPKDPRWVGAWWLGFLISAGMVALAAIPYFFFPRE
MPREKHELHFWRKALAGAASPVNKVEDSPSEQSPGKSSKKQDNPTQMALDLTVIQFIKAF
PRVLLRTLRHPIFLLVVLSQVCMSSMVAGMATFLPKFLERQFSVTASFANMLIGGLTIPM
AIVGIVVGGILIKRLHLGPMRCGVLCLLGLLLALVVGLPLFFLGCSAHHIAGINLQPDTQ
PRAELFPGCMAPCSCPVDGFNPVCDTDALVEYITPCHAGCTAQMVRADLDTSKVFYSNCS
CVAGGGPVPAGSCDSACSHLVLPFILLVSLGVALASVSHTPSFMLILRGVKKEDKPLAVG
IQFMLLRVLAWMPSPVIYGSAIDTTCVYWALSCGRRAVCRYYDLDRLRKRFIGLQFFFQI
GSLVCFALVLAVLRQQNKEEETKEAVSSPGAQQQLLMSGSDKKPKDSSV
Download sequence
Identical sequences ENSCPOP00000013568 ENSCPOP00000013568 10141.ENSCPOP00000013568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]