SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000013682 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000013682
Domain Number 1 Region: 20-181,211-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.22e-68
Family BAR domain 0.0005
Further Details:      
 
Domain Number 2 Region: 265-297,328-385
Classification Level Classification E-value
Superfamily SH3-domain 6.02e-18
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000013682
Sequence length 386
Comment (Cavia porcellus)
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEILLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRSSQLNSARLEGDNIMIWAEEVTKSEQELRITQSEFDRQAEITRLLLEGISST
HAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSGTPVPSALPNAV
GSSAMASPSGLGITPASNVTDLKESSGSRKARVLYDYDAANSTELSLLADEVITVFSVVG
MDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences H0VSR5
10141.ENSCPOP00000013682 ENSCPOP00000013682 ENSCPOP00000013682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]