SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000014186 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000014186
Domain Number 1 Region: 16-192
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 7.19e-60
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000014186
Sequence length 204
Comment (Cavia porcellus)
Sequence
MEPWASSPATTPQVERKFHVLVGVTGSVAALKLPLLVSRLLDIPGLEVIVVTTERAKHFY
SPQDVPVSLYSDTDEWEMWKRRSDPVLHIELRRWADLMLVAPLDANTLGKVASGICDNLL
TCVIRAWDHNKPLLFCPAMNTAMWEHPVTAQQVGQLKAFGYTEVPCVAKKLVCGDQGLGA
MAEVETIVEKVKEVFSQHHGIQQS
Download sequence
Identical sequences H0VU15
10141.ENSCPOP00000014186 ENSCPOP00000014186 ENSCPOP00000014186 XP_005000878.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]