SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000015443 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000015443
Domain Number 1 Region: 139-222
Classification Level Classification E-value
Superfamily DEATH domain 5.76e-16
Family DEATH domain, DD 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000015443
Sequence length 231
Comment (Cavia porcellus)
Sequence
MLYNSSHSRGVASVDNALKGQDRDREGVWTRAGGALAPNTSFSFPPEPPGASGSIIPVYC
ALLATVVLGLLGYVAFKCWRSHQQRQQLAKARTAELGALSRDQRLGDSSVFMDLPSGLES
CVSSQGPHTDLGCRLYLHLLRQQQEEVERLLEVSVEPDKGWRGLAARLGYQANAVETMAL
GQVPAYNLLRDWATQEGNRATLSVLQDALAAMGREDVIHVLGTPGEGYSVV
Download sequence
Identical sequences A0A286XVI8
ENSCPOP00000015443 ENSCPOP00000015443 XP_003476948.2.53824 10141.ENSCPOP00000015443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]