SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000016208 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000016208
Domain Number 1 Region: 347-616
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.91e-89
Family Eukaryotic proteases 0.00000000299
Further Details:      
 
Domain Number 2 Region: 99-184
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-32
Family Kringle modules 0.0000193
Further Details:      
 
Domain Number 3 Region: 194-292
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-26
Family Kringle modules 0.0000447
Further Details:      
 
Domain Number 4 Region: 40-99
Classification Level Classification E-value
Superfamily GLA-domain 2.19e-18
Family GLA-domain 0.0000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000016208
Sequence length 619
Comment (Cavia porcellus)
Sequence
MVHVVGLLALLGRDHVLASCTVFLAPQRALSLLQRVRRANSGFLEELRKGNLERECVEEQ
CSYEEAFEALESASATDAFWAKYTACQSVRKPRETLMECLEGQCAKDLGMNYRGEVNVTR
SGIECQLWSSRYPHRPEVNQSSHPGAGLLENFCRNPDGSASGPWCYTTDPTVRREECSVP
VCVGEGRLTVEMIPRARRTKQEVSPSQEDCVPERGQHYQGRLAVTSQGAPCLPWASEQAR
SLSKGKGFSPEVKLEENFCRNPNKDEEGAWCFVAGQNEDFQYCDLNYCEEALQEEAARRL
AEETISGRTTTEAFQTFFDEQTFGAPHPAGSADCGLRPLFEKKEVKDNTELKLLDSYIDG
RIVEGWDAEIGSAPWQVMLFRKTPQELLCGASLISDRWVLTAAHCILYPPWDKNYTVNDL
LVRIGKHSRSRYERNMEKISLLEKIHIHPRYNWRENLDRDIALLKLKRPVSFSDYIHPVC
LPDKQTVLRLLQVGHKGRVTGWGNLREVWKSSTGNLQPSVLQVVNLPIVDRSTCKSSTRI
HITDNMFCAGFKPQEGKRGDACEGDSGGPFVMKSSFNNRWYQMGIVSWGEGCDRDGKYGF
YTHVFRLKKWIQKVIERAE
Download sequence
Identical sequences ENSCPOP00000016208 10141.ENSCPOP00000016208 ENSCPOP00000016208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]