SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018515 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018515
Domain Number 1 Region: 113-172
Classification Level Classification E-value
Superfamily RING/U-box 9.65e-18
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 388-436
Classification Level Classification E-value
Superfamily UBA-like 5.1e-17
Family UBA domain 0.00014
Further Details:      
 
Domain Number 3 Region: 44-100
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000294
Family PB1 domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018515
Sequence length 441
Comment (Cavia porcellus)
Sequence
MASLTVKAYLLGKEGAAREIRRFSFRFSLDSQVEAEAAAAGPGACEQLLCRVAALFALHP
GGFQAHYRDEDGDLVAFSSDEELMMAMSYVKDDIFRIYIKEKKEYRREHRPHCAQEAPGP
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCATCEGKGIHKEHSKLVFTRPPGHLAEGLV
LNRLLRKLKHGHRGWHGWEMGPPGNWSPRPPRAGDIRTSPASESEIKASGPPEDPGVSFL
KNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPGSPESSGTKDKGSSQPSSCSSEPSPPG
SSGAGTAQALAEQMKKIALESPGQSEQMESDNNGSGGDDDWTHLSSKEVDPSTGELQLQM
PESAGPSSLDTTQEGPTGLMSRLVPHLLPEADPRLIESLSQMLSMGFSDEGGWLTRLLQT
KNYDIGAALDTIQYSKQPPPL
Download sequence
Identical sequences ENSCPOP00000018515 10141.ENSCPOP00000018515 ENSCPOP00000018515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]