SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018932 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018932
Domain Number 1 Region: 211-522
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-73
Family Protein kinases, catalytic subunit 0.00000000184
Further Details:      
 
Domain Number 2 Region: 59-140
Classification Level Classification E-value
Superfamily Snake toxin-like 7.77e-20
Family Extracellular domain of cell surface receptors 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018932
Sequence length 533
Comment (Cavia porcellus)
Sequence
MTQLCVYIRLLGAYLFVVCHVQGQNLDSMLHGAGVRSDSDPKKTVESGVTVAPEDTLPFL
KCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQPR
RTIECCRTNLCNQYLQPTLPPVVIGPFFDGSARWLAVLISMAICIIAMIIFSSCFCYKHY
CKSISNRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQ
VGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGT
GSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIA
HRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNK
NHFQPYIMADIYSFGLIVWEMARRCVTGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRL
RPLVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRVKKTLAKMVESQDVKI
Download sequence
Identical sequences H0W7H8
ENSCPOP00000018932 10141.ENSCPOP00000018932 ENSCPOP00000018932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]