SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018998 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018998
Domain Number 1 Region: 21-144
Classification Level Classification E-value
Superfamily Lysozyme-like 4.83e-40
Family C-type lysozyme 0.0000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018998
Sequence length 145
Comment (Cavia porcellus)
Sequence
MRALVLLFLLGCLVVPCGPHILGRCEVARRLHEGGLNYFEGYSLANWVCLAYFESKFNPS
AVYENRRDGSLGYGLFQIHDRKWCGPGRNLCNVDCSALLNSNLKDTIKCVKKIVQGKKGL
GAWLSWSLHCHYADTLPRWLDGCKL
Download sequence
Identical sequences H0W7P4
ENSCPOP00000018998 XP_003477050.1.53824 ENSCPOP00000018998 10141.ENSCPOP00000018998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]