SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000019022 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000019022
Domain Number 1 Region: 597-876
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-77
Family Protein kinases, catalytic subunit 0.00000000368
Further Details:      
 
Domain Number 2 Region: 7-178
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-69
Family Ephrin receptor ligand binding domain 0.00000185
Further Details:      
 
Domain Number 3 Region: 303-506
Classification Level Classification E-value
Superfamily Fibronectin type III 8.11e-42
Family Fibronectin type III 0.00000435
Further Details:      
 
Domain Number 4 Region: 903-963
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.56e-18
Family SAM (sterile alpha motif) domain 0.0000511
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000019022
Domain Number - Region: 232-300,351-361
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00155
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000019022
Sequence length 968
Comment (Cavia porcellus)
Sequence
PVSSFTVNLLDTSTIHGDWGWLTYPAHGWDSINEVDESFHPIHTYQVCNVMSPNQNNWLR
TSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQESQFLKI
DTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCP
AMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAG
YEEQRDACVACELGFYKSAPGDQLCARCPLHSHSAAPAAQTCRCDLSYYRAALDPPSAAC
TRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDITYNAVCRRCPWTLSRCEACGSGTRF
VPQQKSLVQASLLVANLLAHTNYSFWIEAVNGVSDLSPEPRQAAVVNITTNQAAPSQVVA
IRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDKETQSYSTLKAVTTRATVSGLKPG
TRYVFQVRARTSAGCGRFSQAMEVETGKPREVFSFPTVSSRLLPLPWSLGVLISLVVLLL
LLICKKRHCGYSKAFQDSDEEKMHYQSGQGKLPEPQFYAEPHNYEEPGRAGHGFTREIEA
SRIHIEKIIGSGCPGESGEVCYGRLRVPGQQDVPVAIKALKAGYTERQRRDFLSEASIMG
QFDHPNIIRLEGVVTRGRLAMIVTEYMENGSLDAFLRIHDGQFTIMQLVGMLRGVGAGMR
YLSDLGYIHRDLAARNVLVDGNLVCKVSDFGLSRVLEDDPNAAYTTTGGKIPIRWTAPEA
IAFRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPRALHQ
LMLDCWHKDRTQRPRFSHIVSVLDALIRSPESLRATATAGRCLAPTPAPAQNKPGLSPLP
ESDWLDSIRMGRYRDHFAAGGYSSLGMVLRMDAQDVRALGITLMGHQKKILGSIQTMRAQ
LTSTQGPR
Download sequence
Identical sequences 10141.ENSCPOP00000019022 ENSCPOP00000019022 ENSCPOP00000019022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]