SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000019127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10141.ENSCPOP00000019127
Domain Number - Region: 235-327
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00459
Family N-acetyl transferase, NAT 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000019127
Sequence length 422
Comment (Cavia porcellus)
Sequence
MASRSHWGAWFPSLWVHPACVFGVAFLARVALVFYGVFQDRTLHVRYTDIDYQVFTDAAR
FVTQGRSPYLRATYRYTPLLAWLLTPNVYLSELFGKFLFISCDLLTAFLLYRLLLLKGLE
QRQACGYCVFWLLNPLPMAVSSRGNADSIVASLVLMALYLIEKRLIVCASVFYGFAVHMK
MYPVTYALPITLHLLPERDNEECHQSGHSFQAHLYAFLKRLCSRAVLSFVAVAGLTFFAL
SFGFYHKYGWEFVEHTYLYHLTRRDIRHNFSPYFYMLYLTAESKWSFPLGIAAFLPQFIL
LLAVSFTYYRDLVFCCFLHTYIFVTFNKVCTSQYFLWYLCLLPLVMPLVRMTWQRAVVLL
MLWFIGQALWLAPAYVLEFQGKNTFLFIWLAGLFFLFINCSVLIQIISHYEKKPLTKRTK
YD
Download sequence
Identical sequences H0W821
XP_013004649.1.53824 ENSCPOP00000019127 10141.ENSCPOP00000019127 ENSCPOP00000019127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]