SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000019491 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000019491
Domain Number 1 Region: 90-221
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-16
Family YWTD domain 0.0019
Further Details:      
 
Domain Number 2 Region: 40-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 3 Region: 9-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000019491
Sequence length 223
Comment (Cavia porcellus)
Sequence
LIPNCQQMNCQYKCAIVRNSTRCYCEDGFEVKEDGRGCKDQDECAVYGTCSQTCVNTHGS
YVCGCVEGYVMQPNNRTCKAKIEPTDSPPMLLTANSETIEIFYLNGSKMATLNSANRNEI
HGLDFIYKEETICWVESRDTSNQLKCIQITKTGRLTDEWTINILQSFHNVEQMAIDWLTR
NLYFVDHVSDRIFVCNFNGSVCVTLIDLDLHNPKAIAVDPIAG
Download sequence
Identical sequences ENSCPOP00000019491 ENSCPOP00000019491 10141.ENSCPOP00000019491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]