SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000019835 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000019835
Domain Number 1 Region: 20-140
Classification Level Classification E-value
Superfamily Lysozyme-like 5.32e-44
Family C-type lysozyme 0.000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000019835
Sequence length 142
Comment (Cavia porcellus)
Sequence
MMSFFPLLLVGILFPAVQAKQLTKCALSHELNDLAGYRDITLPEWLCIIFHISGYDTQAI
VKNSDHKEYGLFQINDKDFCESSTTVQSRNICDISCDKLLDDDLTDDIMCVKKILDIKGI
DYWLAHKPLCSDKLEQWYCEAQ
Download sequence
Identical sequences P00713
ENSCPOP00000018680 10141.ENSCPOP00000019835 ENSCPOP00000019835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]