SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000019896 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000019896
Domain Number 1 Region: 612-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 696-751
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000506
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 3 Region: 283-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000937
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 449-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000782
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 371-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000172
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 657-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000572
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 7 Region: 741-792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000175
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 8 Region: 539-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000252
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000019896
Domain Number - Region: 343-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0232
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 103-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0491
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000019896
Sequence length 1052
Comment (Cavia porcellus)
Sequence
LQVFRKDGHPVCFDTSNEDDCNWMMLVRPAAEPGHQNLTAFQQGSDVYFTTSCDIPPGTE
LRVWYAAFYAKKMDKPMLKQAGSNGHATGTPEVSTPAEAERERGPWACKVCASSFLELQL
LNEHLLGHLEHGKGLPPGSQPEAAAEPEKEPSAPCGEPPTAPESTTAAAESSGPPKEQRK
KPRRGRKPKGSKPQQPLVISEGKEPAEQVAEIITEVPPDEPASETPDERIMELVLGKLAT
PSDTISSVPKFTSSALALKRGLVLASRHGIRRKLARQLGEHKRVHQCEVCSKVFQNSSNL
SRHVRSHGDKLFKCEECAKLFSRKESLKQHVSYKHSRNEVDSEYRHRCGTCGKTFRMESA
LEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKKHGDKKFACGVCSKMFYRKDVMLDHQR
RHLEGVRRVKREELEASTESLVRYKKEPSGCPVCGKVFSCRSNMNKHLLTHGDKKYTCEI
CGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFIGKIGISSEENEDNSDESADSEPHKYS
CKRCQLTFGRGKEYLKHIMEVHKEKGYGCSICHRRFALKATYHAHMVIHRENLPDPNVQK
YIHPCEICGRIFNSIGNLERHKLIHTGVKSHACEQCGKPFARKDMLKEHMRVHDNIREYL
CAECGKGMKTKHALRHHMKLHKGIKEYECKECHRKFAQKVNMLKHYKRHTGIKDFMCELC
GKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYMLQKHVQLTHDKVEAQSCQLCGTK
VSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQPELSLEQEEMAEGKHS
KAAKRNHKRKQKPEEDAGAPVPEDATFSEYSEKEPEFTGSVGDETSSAVQSIQQVVVTLG
DPNVTTPSSSVGLTNITVTPITTSAGTQFTNLQPVAVGHLTAPERQLQLDNSILTVTFDT
VSGSAMLHNRPSEVQIHPQPEASNPQSVAHFINLTTLVNSITPLGNQLSEQHPLTWRAVP
QTDVLPPPQPPAPPQQAAPPQAPAEQPQMYSY
Download sequence
Identical sequences ENSCPOP00000019896 10141.ENSCPOP00000019896 ENSCPOP00000019896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]