SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000020767 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000020767
Domain Number 1 Region: 186-393
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.16e-53
Family DBL homology domain (DH-domain) 0.0000000117
Further Details:      
 
Domain Number 2 Region: 2-231
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-45
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 380-496
Classification Level Classification E-value
Superfamily PH domain-like 4.54e-25
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000020767
Sequence length 496
Comment (Cavia porcellus)
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEEYGMADEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPGPSPPKMTEYDKRCCCLREIQQTEDKYTDTLGSIQQHFMKPLQRFLKPQDMEIIFINI
EDLLRVHTHFLKEMKEALATAGASTLYQVFIKYKERFLIYGRYCSQVESASKHLDQVATA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDAVEKDNLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDRSLANYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHNFQVRDDSSGERDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWM
Download sequence
Identical sequences ENSCPOP00000016927 10141.ENSCPOP00000020767 ENSCPOP00000020767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]