SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000020809 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000020809
Domain Number 1 Region: 832-940
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-24
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 312-437
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 32-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 275-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000072
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 206-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.032
Further Details:      
 
Domain Number 6 Region: 649-755
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000401
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 7 Region: 166-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000369
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000020809
Domain Number - Region: 729-828
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000706
Family Growth factor receptor domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000020809
Sequence length 1018
Comment (Cavia porcellus)
Sequence
SGARALRWHLCVLLALGARGRLAGGSGLPGAVDVDECSEGTDDCHIDAICQNTPKSYKCL
CKPGYKGEGRQCEDIDECENDSYNGGCVHECINIPGNYRCTCFDGFMLAHDGHNCLDVDE
CQDNNGGCQQICVNAMGSYECQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRET
PKGGVACDCRPGFDLAQNQKDCALTCNYGNGGCQHSCEDTDTGPMCGCHQKYALHSDGRT
CIEKDEAAIERPQFNATSVADVDTRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPIG
FTLQPDGKTCKDINECQVNTGGCDHFCRNTVGSFECSCRKGYKLLTDERTCQDIDECSFE
RTCDHVCINSPGSFQCLCHRGYTLYGTTHCGDVDECSISNGHCDQGCVNTKGSYECVCPP
GRRLHWNRKDCVETGECLSRAQGSPQAQLSCSKAGGVESCFLSCLAHTLFVPDSENSYIL
SCGVPGLQGRTQPKHNGTSAGSGPGCSDSPTAPIKQKARFKTRDAKCHLRPRSRERAKGT
QRLPLLDNCHVASMTLKCDSSKKRRRGRKSPSKEVSHITAEFELELKMEEASEACDETCI
RKQAEQSLQAAIKTLRKAISRQQFYVQISGMEYEVAQRPAKAPEGPGTCGTGQVLQDGKC
VACGPGTYFSGEQGQCVPCVSGTYQDLEGQLSCTPCPSSDGVGLAGAHNVSQCGGQCSPG
SFSADGFRPCQACALGTYQPEPGRTSCFPCGGGLLTKHEGATSFQDCEAKVHCSPGHHYN
TTTHRCIRCPVGSYQPEFGQNHCITCPGNTSTDFDGSTSVTHCKNQHCGGELGDYTGYIE
SPNYPGDYPANAECVWHIAPPPKRRILIVVPEIFLPIEDECGDVLVMRKSASPTSITTYE
TCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYAS
ENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences ENSCPOP00000020809 10141.ENSCPOP00000020809 ENSCPOP00000020809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]