SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro00497 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  101510.RHA1_ro00497
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-18
Family BPHL domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro00497
Sequence length 122
Comment (Rhodococcus jostii RHA1)
Sequence
MQTLQPIFDKREQLAQIQSGLLQGESVIAVYDCIGTGTGFVALTDRRVILQDRSFVGNKT
AITSIPYGKIRSVSVVSNKSWAGAFFSGGSIAIDAGKVHTAEFRGMDKSRHVHDVILWHI
TR
Download sequence
Identical sequences J1RBD9 Q0SJF3
WP_009473107.1.53434 WP_009473107.1.60566 WP_009473107.1.78234 101510.RHA1_ro00497 gi|111017519|ref|YP_700491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]