SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI26766 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI26766
Domain Number 1 Region: 553-627
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.2e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 623-697
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.21e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00015
Further Details:      
 
Domain Number 3 Region: 1008-1090
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.94e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00058
Further Details:      
 
Domain Number 4 Region: 932-1006
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00039
Further Details:      
 
Domain Number 5 Region: 191-268
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000877
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 702-774
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 7 Region: 475-551
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000804
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 8 Region: 412-485
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000121
Family Eukaryotic type KH-domain (KH-domain type I) 0.0005
Further Details:      
 
Domain Number 9 Region: 270-339
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 10 Region: 321-408
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000511
Family Eukaryotic type KH-domain (KH-domain type I) 0.00011
Further Details:      
 
Domain Number 11 Region: 840-931
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.00074
Further Details:      
 
Domain Number 12 Region: 108-194
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 13 Region: 769-843
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000497
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Weak hits

Sequence:  10228.JGI26766
Domain Number - Region: 80-121
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0061
Further Details:      
 
Domain Number - Region: 1106-1153
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI26766
Sequence length 1244
Comment (Trichoplax adhaerens)
Sequence
MDTISDVVDDQKPDYPQAFPPLPTSSRPQETTTNMKWGPSALPSIPSSSITQVFHVPMEE
RKFGRHGEQVLGPEQQQAQVCKEVMQKTNTTIEVSSTKDQTLTIMVTGKKDAVAKAKRLI
LIGLQKQSAIELPVQKEYLGAILGRGGKSLQQLELTTSTKIKVIGEGPIVNIRITGSRDK
IDDARHQILVLVDQQEKLAHERLNISKIYHPFISGPNGSIIKTISEKTGARIHVPPISVE
KDEIVVSGEKDGVLKAVKEISAIYNEKRRKCKTVSVEVKKSQHKYVIGHRGQGLQEILEL
TGVSVEVPPSDSNSETITLRGEQEHLGNALTHVYEKANSTISEKVDAPVWLHRHLIGKKG
ENISKVLQDMSKLHVEFERDRDLIILEGKPEEVQVVKKNLQKFMKNLVDKMDHIEIKINR
RFYKQLIGKNKANINAIKNQTGTMIYFPSDESSEVISIEGDSDGVKLAKEKILSLVKKWE
NERVKDLVFEQKFHRRIIGSKGSNIREISAAYPEISINFPDPQSDSDVVQVRGPKDDVDK
VCSKLKKIYSNLIESNHVEEFSVFKQFHRNIIGKGGITIRKIREETNTRIDIPNENSGSD
IIKVTGRQKDVKMAREKILAIQKELANVEEITVSIPQKYHNRLIGSKGKLIRSISNDCGG
VIIKIPDGKTTSDKIVIRGPKDDIKNAKAMLLEIANEQELHSFTTEVRAKPEFHRFLIGA
GGRKINKLKQNTSTRIIFPTQKDEDKELIVIIGTKENIEKTKAELEDQIRELENTKEETI
SIAPKYYKRLLANGRQILREISEENGNVIISIPRDNASDKVIIKGSSSCVDSAKVKLLEI
VDEIDSMVTIDCQVSQKYHKNILGVKGCNIQQVVSDFKVDVKFPNKSANRQKNLPNGGAV
DDNDPIKTDIITITGLPANVEGAKEAILSFVPISEEMNVSIEYHRSLIGVKGRDIRAMME
KYSVNISVPPADQHSDCIKIFGTPSQIEKAKSAILDRIKELEEEKEDKKKRNFQIVVEVD
PCHHSKIIGPKGSTISKIRADHNVQVKVPSDKESNDRKIVITGYENEANAAKLKIEKIVQ
DLENQIVESYTMEYRIQRNISRLPDIREITKDRKVSIKFSKDQENNNVEITGLAENIEGA
KKDLDKLIETEREKIEEKELLSHYMYKREERQDHQSSSRGRNSKSRGYVVRNAPWDHSQG
LSPPSTTDTQAFPAFGDSIDSNGPNSNWGPSQNTALSGRNIQDY
Download sequence
Identical sequences B3S083
10228.JGI26766 XP_002113869.1.101920 jgi|Triad1|26766|e_gw1.6.608.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]