SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI8175 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI8175
Domain Number 1 Region: 4-120
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.17e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000673
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI8175
Sequence length 123
Comment (Trichoplax adhaerens)
Sequence
AIKVQDKVMIPQDDYPTINFIGLLIGPRGNTLKRIEKESNSKIMIRGKGSTKEGKAQLYP
NSGEDEALHALITGSTADGVKIAVNKIHEIIQCGIDSPEGQNDLKRMQLRELAQLNGTLR
EED
Download sequence
Identical sequences B3SA18
XP_002117129.1.101920 10228.JGI8175 jgi|Triad1|8175|gw1.21.187.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]