SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.all0332 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.all0332
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000275
Family Serralysin-like metalloprotease, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 103690.all0332
Sequence length 122
Comment (Nostoc sp)
Sequence
MTGGTESDRFLYSSGRAFTSNDFGIDILTDFTSGIDKLVLSKNTFRALTSVVGDGLSQVS
DFTTVEDDDLAATSTAFLVYSIGSGSLYYNQNGSAAGFGTGAELANLINLPSLTAADLAI
VA
Download sequence
Identical sequences A0A1Z4KQP3 Q8YZX3
WP_010994508.1.33676 103690.all0332 gi|17227828|ref|NP_484376.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]