SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.all5108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.all5108
Domain Number 1 Region: 2-272
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.69e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.012
Further Details:      
 
Domain Number 2 Region: 347-426,458-488
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000722
Family Filamentous hemagglutinin FhaB, secretion domain 0.058
Further Details:      
 
Domain Number 3 Region: 247-339
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000628
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 103690.all5108
Sequence length 733
Comment (Nostoc sp)
Sequence
MTGSSISHIDGLIQANGSANLFLLNPNGIIFGSNARLNIGGSFLGTTADSINFSDGFIFS
TTDTTTPSLLTMSVPIGLQMGQNSGSIQVQGQGHNLLHPTNFLAPVTRDPQLGGLRLFPG
KTLALLGNGIQLDAGVLIAESGHIELGSMTAGTVHLNTNTPIWKFDYHSGQILSDIYLTR
AALIDTSGNPGGSIHLQGKDIHIQNSSSVFIQHQGQQRPGSIKINADLLAMSGALPQKNP
SFILSENLGSGYGANIDVSARQLIVQDGGGILSTTYTNGGKGGDITVTAAESIQIIGFSP
INFRASGINSPSFPGGGKGGNISIATRDLIVKEGGTITSLVEGGGSGGNIHMTADIISLF
GENPGSGGASAIATSTFFGGDGGVITINTRQLILRASGVISASTSDTGNAGDLTIYASES
VEVDGSNSVLRDHSRITASGQRFRPRYLQNRGLSAFPSGNGGNLTIISPTIKVSNEGYIA
AENIGSGNGGYLQIQTDSLLLEQQGQIRTAAASGQGGSLGLIVGDILLMRHNSLISARAG
NNGNGGNITVISPLIVGLENSDIIANAVAGNGGKIQITTQGLLGLEFRDGETSESDITAS
SQFGVSGTVQINNVGVDPNSGLVELPENVTDPSQQIATGCSNTNSSSFVATGRGGVPQNP
TQEVRSDRTWSDTRDISAFQNTPQIQAQTPIQPQIPIQATSWHRNTQGKIELIADKSSVN
LQSSLTCTAFHKG
Download sequence
Identical sequences Q8YM33
103690.all5108 gi|17232600|ref|NP_489148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]