SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.all5110 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.all5110
Domain Number 1 Region: 21-343
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.39e-38
Family Filamentous hemagglutinin FhaB, secretion domain 0.0075
Further Details:      
 
Domain Number 2 Region: 412-551
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000251
Family P22 tailspike protein 0.066
Further Details:      
 
Domain Number 3 Region: 311-411
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000471
Family Filamentous hemagglutinin FhaB, secretion domain 0.042
Further Details:      
 
Weak hits

Sequence:  103690.all5110
Domain Number - Region: 552-645
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000596
Family Filamentous hemagglutinin FhaB, secretion domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 103690.all5110
Sequence length 795
Comment (Nostoc sp)
Sequence
MKITFANLSLLSAIYILVIGNISVHAQVTPDNTLNTSVSGSNHYSITNGTRVGNNLFHSF
SQFSIPNNGSALFDNASDVQNIFSRVTGGHVSTINGSINAKGSANVFLINPNGIIFGANA
RLNIGGSFVGTTANSIQFLDGVEFSATNPTISPLLTINIPLGLQFGQNPSAIQVQASGTQ
LQVPTGKTLALIGGDIFVDSRNLSTSQGRIEFGAVGEGTVSLTPNNLGWSLGYQDVQSFG
NIDLSNQTLLSTGGNGEIHLWGANVSLSGGSRVSIQNMTNVQTPGKISVHATKLLTVTGD
NPSGTTTSAVRAGAIGTGMVGNIEISTRDLMANNGGIILTSNISNSVGGGNITVNASGNI
QVAGVGKISTNRSGISGLTFLSGKGGDVSVVANRLEILDGSVVTTSTIGTGAAGNVTVKA
TESIELAGVETVSTSFAPSSLSSSTLAAGNSGNLIVNTARLSVQSGARVEASSYASGKAG
NVTLHATESIEVAGKPRQSFLIPSFIGSSTVQQAGTSRVLTGNSGDVQITTQQLKVANSG
LINVRNDGRGNAGMVKINVNSLVLNTQGAITAVTQMGEGGNIDVNTQTLLMRHNSAINAT
SNAIGDGGNITINSPIIVGLENSDIIANAVHGKGGNIQITTQGIIGLQYSPQLTSENDIT
ASSQFGVNGTVEVNNIGVDPKSGLIQLPANITDQSQQIASGCSNTTGSSFVATGRGGIPQ
NPTQEMRSDRTWSDIRDISAFQNRPQIQSQTPTQPQILIQATSWHRNTQGKIELVAEQSS
TQAQLSLTCAAISKS
Download sequence
Identical sequences A0A1Z4KP22 Q8YM31
103690.all5110 WP_010999236.1.33676 gi|17232602|ref|NP_489150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]