SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.all7165 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.all7165
Domain Number 1 Region: 3-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-21
Family Beta-D-xylosidase C-terminal domain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 103690.all7165
Sequence length 183
Comment (Nostoc sp)
Sequence
MEWLNEPPNWSHSDQKIIVTTSPKTDFWRITHYGFIRDSGHFYFDRVSTDFVVDVKIKGN
YKDLYDQAGIMIRADEQHWIKTGIEYVDGVQNLSAVVTHNYSDWSFTPLLNPPNIFQVRV
ERCQEAIHIAYLDEYSRYVPFRMAYFPVALDIQVGIMCASPQGNGYEVIFEDYQLTKKGE
KLS
Download sequence
Identical sequences Q8YKX3
103690.all7165 gi|17233181|ref|NP_490271.1|NC_003276 gi|17233181|ref|NP_490271.1| WP_010999722.1.33676 NsR24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]