SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.alr2090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.alr2090
Domain Number 1 Region: 3-324
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.25e-45
Family Pectate transeliminase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 103690.alr2090
Sequence length 602
Comment (Nostoc sp)
Sequence
MTQTFYVNPSTGNDANPGSQTAPFKTITQALKVASPDTTIQLANGNYNAASGEVFPLTIP
SSVKVVGNETSKGSNILIEGSGNYLSRTFAGQNVTFVLLNNAELRGVTVTNPASRGSGAW
IESTTPTVANSTFINCKREGVFATGDANPVITGNVFTENAANGMAIAKNSKGQIQGNICF
KTGFGIAVSDTTSPTLIDNKIYENRSGIVVSGTARPILRNNLVENNTDDGLTVIGNALPD
IGNTSNPGGNTLRNNAKFDLQNASSHKLISIGNQLDTTKVTGNVEFIVSQIPTPTPIPTP
TPTPIPTPTPTPIPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPIPTPIP
TPIPIPTPIPTPTPIPTPIPTPIPTPTPIPTPIPTPIPTPTPIPTPNPINLKDIGNHWAA
PFIRELVRQGIVSGFPDGTFKPDATMTRAQYAALLVKAFNPSPNRAVIRFKDLAENFWAF
KVIQQAYQGLFLAGFPDNTFRPNDNIQRVQVVVSLVNGLGLGLSANVTNTIKAFDDQAKI
PDYAKDEVAKAIEKGIIVNYPNIKQLNPTRDATRAEVVAIVYQALVDGDRVAAINSPYIV
NA
Download sequence
Identical sequences A0A1Z4KFI0 Q8YV91
gi|17229582|ref|NP_486130.1| 103690.alr2090 NsR99 WP_010996248.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]