SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.alr3268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.alr3268
Domain Number 1 Region: 15-306
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-55
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 399-515
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.31e-29
Family Pentapeptide repeats 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 103690.alr3268
Sequence length 524
Comment (Nostoc sp)
Sequence
MSYCINPTCPNPENVAFSQKCEACGSPLLLRDRYRVLKPLGQGGFGATFLAHDQILPGEP
SCVIKQLRPSGTAPHILQMARELFEREAKTLGTIGNHPQVPRLLDYFEEQEQFYLVQEYI
SGSTLQQEVKLNGTLSEPGVKQFLSEILPLLQYIHEHKVIHRDIKPANLIRRSQDARMVL
IDFGAVKNQVSQAITNQSANTALTAYAIGTPGFAPPEQMAMRPVYASDIYALGITCVYLL
TSKTPKDLDYNPTTGEVMWEHLVQASDHLIGVLRKMLEVSVRSRYQSATDVLKALEIEPY
LESLAQGLLVKSEKEQTSQRPENSAVLSSSSPVAATSVGGVAQVAAAIRARRAKDAAAKL
AILPNSNSNGNGLPTQQSKAGRRLDSQTLMKAYLKGRRDFALHNLNFLNLQGVDLSETNF
HSAQLQSANLQGANLHNSDFGRASLTRANLKDANLNKAYFNHADLEGADLRGADLSHAYL
SNANLRGTNLCGANLTGAKITDEQLALAKTNWMTIRPNGKRGLL
Download sequence
Identical sequences A0A1Z4KIU0 Q8YS23
gi|17230760|ref|NP_487308.1| WP_010997419.1.33676 103690.alr3268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]