SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI103378 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI103378
Domain Number 1 Region: 913-989
Classification Level Classification E-value
Superfamily RING/U-box 0.00000177
Family ZZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI103378
Sequence length 1159
Comment (Postia placenta MAD 698)
Sequence
MDESGATTAIKNAVSGFAETLPVLMKALDDIGKIHPVIQGSILAHEASVAVLAFKAVYTL
ETKRRNNDAKVIALFVEMRDMIGVLLQYGVLASSVELKNVKDEAITGPKGVTIEARLQGL
MKQTASDIRSCGNVCDAYSKMSLLAKVLKGPLWEGTFASFVSKFSQRRDDIEFALSIHIA
GKVDGLHDKVDDLAQIVERKTDMIMEFLKNYTPPEHTDVCKQIDRRGGREAVLKNDDALQ
ELVSTRLETNSSRPSNQATALARNAKHELESQLIDPAFQIQKNTQSFDRKFEMQQRQILE
GVGEIVHRESDRVIETVTSGPHDRILDKDLHQIWKDMGWRGSVKARHFVLALRDYEQERR
EEKMRKEATFQVAPTFDPDAWAFDWITVKRLQAITEALDDDASGFITVTEANNFTSSRPA
DWSLPQWLAYWAIGWQISATIHRDKIHEIFEKMFAMRQHLHEANVLMVDSYLSAVWTDIC
GLSTSLEPFYATPQLLERFQSYIDAEEERLRKNLEAIKYHIDDSTSLALVTGSGRIEKYL
FPLIYLLLKHVYDVFRIGRKEIVNDRHSIDAFDSQWTIDQAVRNRIDDLKGDGQKLTRCD
KSLMSSLASLKHQRLDLAHHFEHAYSKLYHLTYLSMEDSDSPVPLKAIQAFSYKAVTYDD
TEEDKDVPTAETVLFYAYDQSQLNAGANAMEDTATDEDRKATGNLKNILGRWTGYNYTNT
EYPFSVMFTVFIHTLNAESTQYEALVHVPDSKVEFKLAGDIVPEADGKVTYQFRLIIPIH
GMLVEYDGTLNEDGSMLSGKWGSNAVRDALFFLSRMPAEVLLCRPSPMELQTDRIRALWR
FALTAVQEQVSRRRFTWKFLAKRRDVRHRYMDLALRTQLGRPLNEAEDEEGRKCMRALTP
LDALICHHVMELRKRTICIHKGIFCDSCDAHDQEITGGRIVCLTCDRDGGESIDLCEDCI
VTEVDRTKRPDLAAPHLPTHDLYKLRSLVHQREFRSIVLMARNALERARTAFKDAQDVAH
DRTEEDGTGEAEDRLTKIVEEDLTCIKCKERVTQPCWYCIVCEDAVFVCMKCDAGGGVSE
GKHAKTHGLVRCQEEIVEEAEVPAEEKLESMVTSKFAKVDGQFEEVDTRLRQVDERLSRM
EQLLQAIVLKMGAGQDGST
Download sequence
Identical sequences 104341.JGI103378 jgi|Pospl1|103378|fgenesh3_pg.185__18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]