SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI108800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI108800
Domain Number 1 Region: 82-135
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000486
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI108800
Sequence length 499
Comment (Postia placenta MAD 698)
Sequence
MSDEASSSSATRPSALLADMFRPDSSEHTRTVAGLKRRASSSFEGMQDESSRKRLKEKSV
SEPSGSGPGDSETVDGEALAKDLEQELQCACCSALVYRPVAVIPCQHFFCGSCIVMWIRN
GGANCPACRSVASVATPSRIIEKMVDVLLRSVPSKVRPVNERIQADEIYVAGGTIRIPSP
RQPSPDPPLPHRNTNFVHPCPHCTPDNHYGWRCPRPIVDPEADPDRAWHADDGSPPGHAY
CGNCENVLALEAPSTTKCDFCQVSFCGIGIPGRCVAAPILQQHLHGLADLGDLVQCSQIY
DSFDGNTVEVDIMLDYLTAQRINPRFIYREIIMHIHSQPGQFAPLFELDLFADVHAVSAG
PEPGLDTPRNKVCRVCAAEIFLWGVRDWWVRERRKGFLEEEVTRRLDCPEGRMCPRQKDY
AHAKEFNHVVCPPGEAATPSTSANGASSSRLAALEDNAALPPLLNTEPATPLEAALFSHL
AAEFPDLSQDFRDEVEALL
Download sequence
Identical sequences A0A1X6MU19
jgi|Pospl1|108800|estExt_Genewise1Plus.C_10370 104341.JGI108800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]