SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI114833 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI114833
Domain Number 1 Region: 204-393
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-31
Family WD40-repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 2-54
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000015
Family U-box 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI114833
Sequence length 406
Comment (Postia placenta MAD 698)
Sequence
MFFCSISGEPPQDPVISQKSGHVYERRLILKYITENSTDPITGEKLEESDLITVKANPKT
AAPRPTSATSIPALLHTLQNEWDALMLETFSLKQQYNSVRQELSYALYAQDAATRVVARL
MRERDAAREALASVSATMGIAPAPSGDDVEMSEPGQETVALPEEAAKQIEETRETLSSKR
RKRKPPPGYVNPADVKTFTAKHTIPSLHSTSPSGITALAVSRSEPSQFLTGGNDKVVQLY
DRSTDKVLASLKGHTKKVTAVAFRDAFSESEPTLLLSASADKIAKVWAHDSASGEYIPRA
TIRTHRGELSGLAVHPTKTLVALASADRTYSLHDLTTGNLVYRSPVGDEPFASLGVHPDG
TLVAVGTPTSTIKVFDIRSGAIAASLSPPESITNLPLLVNLTYPLN
Download sequence
Identical sequences jgi|Pospl1|114833|estExt_Genewise1Plus.C_770038 104341.JGI114833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]