SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI126585 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI126585
Domain Number 1 Region: 281-358
Classification Level Classification E-value
Superfamily RING/U-box 0.0000373
Family RING finger domain, C3HC4 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI126585
Sequence length 651
Comment (Postia placenta MAD 698)
Sequence
MDFPSQSIHFGRVGHKLAAGFGSGADTPTSGRWATEDREVDTWITYYIWLPSTTLRSLRG
EATLAAVLDADWLRTMSGDADVLSELLIARILEEEMLALTHAQEAEKIQVDLMIDESDLL
AGKGSGKHKAVAQDPISDSDGDLVLKMVIKELRMSSDATLAQALQHSDDVTIIASQQHAQ
RLAAAEKKLLLDAEFARRLQAVDDNANADIDTAEYMDAETVLGRETIEQLLASDPNDKGK
KSVTGKGKGKSPVSLYNIKQSSQDDETVNKDVDVPSVAYPICGICMEPFQATHSPLASSA
SANSSARLKFGLRLPCPGVHAYCMGCLGDYIRSKLDPDGDETTSMNRVVFPIRCPECPLI
EWADGIPDEVATRILPEKNMVLWHHQKLLDSMPRYYCPNPRCSAVVWHESPALAQMPELL
SLWDVRRQRCTRNPACDLWDEEMLLEERERERDHRQDRVARMFAPREESPPPYEAPPVPP
VGHEEPDDHGTDGGDDLEYWMDPEPGNFDWYDDTGISDGTDDVGTFDWMDDPNVFCTRHW
FTTQMIQTLTCGYCDAKLNSFADLRYHLGHVRRHDVFACCGRFFKREKDLERHLDAEPKR
FGRHVHTRELRGRYRVSASDSSDVADAESATSDLIKTSVFQGMHSAKTHEL
Download sequence
Identical sequences 104341.JGI126585 jgi|Pospl1|126585|estExt_fgenesh3_pg.C_110028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]