SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI127145 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI127145
Domain Number 1 Region: 2159-2387
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.91e-34
Family Tyrosine-dependent oxidoreductases 0.0016
Further Details:      
 
Domain Number 2 Region: 432-646
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.54e-29
Family Tandem AAA-ATPase domain 0.00046
Further Details:      
 
Domain Number 3 Region: 1048-1140
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.84e-24
Family Tandem AAA-ATPase domain 0.0011
Further Details:      
 
Domain Number 4 Region: 676-747,861-931
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.13e-20
Family Tandem AAA-ATPase domain 0.011
Further Details:      
 
Domain Number 5 Region: 1893-2081
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.22e-18
Family Carboxylesterase 0.013
Further Details:      
 
Domain Number 6 Region: 779-840
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000011
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 7 Region: 4-105
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000413
Family PARP-type zinc finger 0.023
Further Details:      
 
Domain Number 8 Region: 1475-1569
Classification Level Classification E-value
Superfamily BSD domain-like 0.000000000392
Family BSD domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI127145
Sequence length 2417
Comment (Postia placenta MAD 698)
Sequence
MATSHIFEYSKSSRAVCHGPPPCKGSPVQLGVLRYGEVSFGQYGETVEWRHWGCVTPEIL
GRLASTKLERVPGFKDLRSDDQAKIRMAVGLRRIAPADIPETAKTHRPGSDIATSPPSTP
GPSQKKRKAAAIMASNSSQPSSSRPGPSQPLRHVIRPEGYRRFEEEEDEVNEVEEIKDEL
YVVLKTSIVGIQYYKGLVGPGEEVRLVREPQNQHDRNAIQVMNIGGTQVGHLPRNVAGKL
APLMDQGLVTVEGVMHEGNLRGFAYSLSMSLKMYGASDKRALLEPRLMWATPGQRGFPPR
NGVNTPVPGLPAPRPPPHVTPSRPPASQSYPLASKGYPSSQGSAYPSSSQRATGMTAAQQ
EAARKQQEAARKQQEALAKAAELRQVLNSLEKVDDEGRRSSLLDTLCVVEDVLGLPLHPS
PPGIANGDLKVDLLKHQSQALQWCIQHEYPALPKKEEDKPVQFWQLRSAGGKGKTLTMLA
LVIATKADIPTEFSKSTLIVAPLSILSNWEKQIQDHIQEGALTYCVYYGASRSMTPEELK
NYDIVITTYQTVAGEHGDASVTKVIGEEPVKRKRKSANALFAVPWKRIILDEGHNIRNPR
TKMTKAVCALNAQRRWVLTGTPIICRPLDDEDFYKRMVLRPLKDGDPAGAELFRGLMSHI
CIRRTKEMQDSEGNHLVPLPPVDTTLIPVTLTKEAREMYDAIEALSKQRLDNLIGQHGGL
HSAAVHSNVLSMLTRLRQLALHPGLVPANYIQQLQAAEKEEDSLSPVQLTPENKIRLQSI
LAQAIEDNEECPICFGILNEPRITSCSHMFCLACISEVLSRDSKCPMDRRPLGMGDFVEP
PPPTMFTQAPVRDDDEPEEENGLRSGSSAKIDQLVHLLKLTPDTEKSLVFSQFTSFLDKI
AETLEKEGIPYVRFDGKMSARRRQETIARFSVPLDESSPTVWFPQSQEPSSSGRSARRRA
RASNVRIFDGDAAAVDDDGDADFAPADDGEDSDFIDDEDADDAPRPKGKSKKAKAKAKGK
GKRVRISTAPPSESNYLDGSAFGNEVNPKVMLISLKAGALGLNLTVANNVYLMDPWWQEG
IELQAIDRCNRIGQTKPVHVYQLIAEDTVESKVIDIQDKKKRLVEQAFSSIKNKETQRQK
KEARLQVCDHLGVYPNLTGLQYTTSLHECCNDRVGMNFLDGYEITSPPTPPAGQQPEPSL
NEEVSQVVGQLSRFWGGFRKQSQTVLEAARKDLVSQAQKELSKLTEPSEASTSTIAPSGS
TETDSSAETDLEKEKDSDADSTPSGEASSSTSTIFPPDATDQEQQSSTLFSRLQASLPPH
IVSAVQENIPDSIRHARGLSLTAPDLTALRSTLTSELQRVQGSSGELLQRGEGLLQRMQG
SGGHLFQRVQGGGEELLREAGEFLKEAVRVVPPEEGGRNASTAVVWDGTDVWMIPTYAEE
PASTRAKGKERERSQSTGSGTGSGRQSMDSVRAATTRAEAMLAQLRHDPKVLRADPAAEG
EAFGEWVAELGAEGIESETWLARREKELDERPELTALLEALVTEEVNESTFWTRYFFRVH
QVEREEERRKALLQRTTENEEDFSWEDDDDEATSPTAAKPDATTPSAPVTPATAKPAPTP
TVAKLATPTERSRVSTPTSASRRPSSEESYDVVSSQVSRGGSTSGVESGDKEEADEEEDD
EEDNEEEVAAAKPRQDRKAEEEEEESDWDCAYRLSPDVREELTPQSTYSNSECTSPCVSP
AKFLPAVTLTFGLSRIDEDISQCPVHDINTAKQAVGGCPINELPRIRASWECQHAAAMFV
VPLLTQLRLGGREVFRSATFAWMYERPPRLLWPPHCAIQDNADAKGVWLEPVPKTVVGEI
KKWACESNVQPERTPGYWIDKPGHDTAAGATAGPDEKVVLFFHGGELTGEPARGHANLVH
LPYAVLSQCPSARRAFAVEYRFCNLSPVYSNPFPAALLDAIAGYRYLVDDVGVDPANIVL
LGESAGGNLALALARYIAQNTAELSRVMRNMPSACPDYEMILLSPWCDLGTSHDTPGSGS
LVHSYDFLADLQTGVFAAARQAYGDPLGFSATDRNPYLSPASRYVSRGHSSALGGLSALW
VLLWYGTCLRSIFWSASPTLIPKWDDWSSDNLEVIKNVSDASPGPKRRQSAKSTIMSDPK
VWLITGSSSGFGRELTEFVLKNGDIAVATLRKPEALADLSSTYPLSQLLVLKLDVTNPSE
IVSAFAEAEEKFGRIDVVFNNAGYGVLAEVEGTPEEVARGMFEVNFWGAAAVSREAVRFF
RDVNKPAGGRHALEGLSEAIAAEVDPAWNIKVTIIEPGGFRTKITSSSMQLIPAHPAYNN
PDTQVVMFRQYLESNPVMPGDASKAAGVFHRLASYPDPPLRFPLGKDCISGVRRKTAKLL
QDVDNFESWSEGTEARD
Download sequence
Identical sequences jgi|Pospl1|127145|estExt_fgenesh3_pg.C_620032 104341.JGI127145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]