SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI127308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI127308
Domain Number 1 Region: 56-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000748
Family Glutathione S-transferase (GST), N-terminal domain 0.0072
Further Details:      
 
Weak hits

Sequence:  104341.JGI127308
Domain Number - Region: 164-295
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00187
Family Glutathione S-transferase (GST), C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI127308
Sequence length 299
Comment (Postia placenta MAD 698)
Sequence
MSKVLSKVSSPVRRLFTKRQPAVLYVFGLSVCSFEHNPLDPADYHSEEVGYPSGAIEKKV
VNLVEGANFTPEFLHLNPRATLPTLQVDGKVLTDTATVTAWIVKHGQKKVIPGTQFIAKL
HEDKYDPNFPLLLVRNEDELKAASSGFPLTFVQNRQDALEKYSKTPEAAAFKQFYEEKIA
SNGSVLAIYKGEAPEDAKAAFFKQSTEHWETISAFIVNDLPSLLPESTFLGGAIPGEDDF
HLGGWLARLVHIAGGKIGKDGINALEKETKQPIPEKVVAYWASWNERPSWQKVYAEGLH
Download sequence
Identical sequences 104341.JGI127308 jgi|Pospl1|127308|estExt_fgenesh3_pg.C_1430043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]