SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI128768 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI128768
Domain Number 1 Region: 889-923
Classification Level Classification E-value
Superfamily RING/U-box 0.00000751
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  104341.JGI128768
Domain Number - Region: 66-246
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00106
Family WD40-repeat 0.064
Further Details:      
 
Domain Number - Region: 432-488
Classification Level Classification E-value
Superfamily TPR-like 0.0303
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number - Region: 851-902
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0589
Family Rad50 coiled-coil Zn hook 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI128768
Sequence length 1092
Comment (Postia placenta MAD 698)
Sequence
MFDEYVEHASAPGLSYGTLPQVQYEGFEPSPYEEEEAQMNSIGLADQLDVAPAAPLFDLS
RVQYTLPAPLMSLVVSSDVLSMGLSNNFIVQIELSRSEQVVKIPIPRKPTEFLIHKLFLD
PSGRHLLVTSLTGENWYLYRGWKKPKQLKNFKMVIESVAWNKAALLASAHSTSTREILIG
ARNGTIYEAMLDAEEDFFKSQERYCQPVLTLPERQPVTGLKFEFFPPSDPRRALVIVTTP
SRIYQFVGTPDRRSDDNGRVFLGLFASYRDSPQKFSELPGNVDYSELHTYGSNAGQANSL
PRNLAWMTTPGIYHGMLNFESTSDDLIDGAQLLPYPVLTSPSASPAQASGLSDVPLSMAL
TEFHFVLLYRDRVVSLSSLNEQMTYEEMLPVKPNEGVKGMAADPVRGTYWVYTDQSLFEL
VVTNEHRDVWRIYLDKGNYDAALRYAKTASQRDHVMSAQARAFFEEGRYFQAAQCYAQCS
VSFEEVTLKFLDVGERDALRSYLTSRLERTKKTDISQRMMLATWLVEFYLSKCNELDDLI
ASESVSHDVDNLHAEHTILEDDLRQFLQTYKANLDPKTVYELILGHGRTDMYLHYATVIS
DLERVVEHWIMEEEWAKAIDVINRQSNLELYYRFGPVLIRQAPKETVDSWLRQQALDPLR
LVPALLRLQHAPRDPLSPNQAVRYLNHVIFERGNTSPTIHNLMITFYAFVPSSSSGSSSA
SHSDDDGPLLRFLSSAPSDPLTGKPYYDLDYALRLCKQAGRTQPCVHIYSKMGLYECSVD
LALEKGDLELAKINADMPEDDEQLRKKLWLKIAKAMRFLENTDLLKIEDILPFFPDFVVI
DDFKDEICNALEGYAAHIDTLKADMDEATRNAEAIKQDIAALSKRFITIDSTEKCSVCGQ
ALFTRQFYVFPCQHTFHADCLIGLTKEFLPSHALRRILALQNELVKSSQKGPLDRSAITN
PSLGAGTPPPRQPAVQRTLLSANFGIGQGHTRGANSLGRNLLSAGDRLRDLISPDTLASV
VTAPAGWIPGIGTGAGAGAKRGGGEKDAEKTERLRRELEDVLAASCPLCESVVAGLDKPF
VQPGEVDASWAL
Download sequence
Identical sequences 104341.JGI128768 jgi|Pospl1|128768|estExt_fgenesh3_pg.C_1110036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]