SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI129274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI129274
Domain Number 1 Region: 114-447
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-49
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0018
Further Details:      
 
Domain Number 2 Region: 4-91
Classification Level Classification E-value
Superfamily RING/U-box 7.3e-19
Family Zf-UBP 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI129274
Sequence length 469
Comment (Postia placenta MAD 698)
Sequence
MYLDTINRAVLDFDFEKVCSVSLSNINIYGCLVCGKYFQGRGRNSYAYAHSIHDDHHVFI
NLETTKVYVLPDGYLVSDPSLEDIAFVLGPSFNRASIEGLSSPSHTQKPSYDLSSKPYIP
GYIGLNDIKRNDYMNVIIHSLLHVPPLRDHLLLSSFRGKEPELLKRFATLAKKIWNPRLF
KSQVSPHEFLQEVGRASAGKFSLERQGDPVEFLGWLLNRLHKDMGGTKKRNSSVIYSTFQ
GQVRMETQQVVVRPDLGGNEKPRFDIDREIKSTVSPFLFLAVDLPPPPLFQDAVEKNIIP
QVGIHSVLTKYDGRTTQESAGQLRRFKCQQLPPYIILHFKRFTRNQFSEEKNPTIVNFPL
RGLDFRDYLDVSQSHPSTLYDLVANVTHESAAGTTRDKESTVWKAHLRAGAGGGENEKWF
LIQDLIVEEIRKEMIFLGETVLQIWERRTEPQSYHNGDGRYGSAMNVDR
Download sequence
Identical sequences A0A1X6NEF8
104341.JGI129274 jgi|Pospl1|129274|estExt_fgenesh3_pg.C_1180047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]