SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI129916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI129916
Domain Number 1 Region: 59-105
Classification Level Classification E-value
Superfamily RING/U-box 0.000015
Family Variant RING domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI129916
Sequence length 504
Comment (Postia placenta MAD 698)
Sequence
MTETRSVSATETGTVMIATGTSSYVSFVGKRSDTTVRTQTCPLRVIAQPRVTADPDDPPR
VWTHPCSCTLVAHESCLLQWIQAAQQDPSKAGNALKCPQCGTRYELESHNPFVLRLLDNV
NKSISIVGKFVSVAGIVGIGVSFGFGVYVVCTAYGSYAVKVFLGKEMYDLLLTDDLSNWP
WHAFVNLPFIPLSLILSRTRFFTSLPLIPLFLPWASTPPVASTQSMMAARWNPLVRKAPV
YPSAPLFGWPPSPIVITIAYSILTSFYRRGYSTLKHWILGTPSNAQHTIREVIWDLGGHA
RIGVNINDGEHPANQDQQAAQGEQAPANGDAGQEQAGDNDPGVVAERTLRVTNASLGRFI
SGALMMPTIANCMGAILLRLSRHSRLLQRFLAVRPPMRGGVPPTLASWLEAQPWGEMSYM
RQVATGLKVALDLVCGGTRTWEECDPVWWRNSIGLGIYIVAKDCIQLLHLYLAKRELETR
RIKNRSFEGIDVKELDLIDRSLRS
Download sequence
Identical sequences 104341.JGI129916 jgi|Pospl1|129916|estExt_fgenesh3_pg.C_1980019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]