SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI42152 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI42152
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.33e-21
Family Ribosomal protein L24e 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI42152
Sequence length 111
Comment (Postia placenta MAD 698)
Sequence
MRIDKCYFCSKSVYPGHGTAFVRNDAKVFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAG
KEMTIDSTIEFEKRRNVPVRYDRELVQTTVKAMKRISEIKQRREHAFWKNR
Download sequence
Identical sequences B8PG50
XP_002474663.1.31404 jgi|Pospl1|42152|gw1.121.120.1 104341.JGI42152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]