SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI43699 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI43699
Domain Number 1 Region: 66-189
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.91e-27
Family FHA domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI43699
Sequence length 193
Comment (Postia placenta MAD 698)
Sequence
MRGGPSHRSASPRRPTSRAQSKAPSKREDSPEDKAKPNFAPSGLLAAATKTVQHVDGTST
VLKYHEPPEARKPAVGWRLYVFKGKEQVDLLHIQRQSAYLIGRDRTVADLAIEHPSCSKQ
HAVIQYRHVQEKNEFGEVKSAVKPFIIDLESTNGTLVNDEMVPTSRYFELKAGDVIKFGE
SQREYVILHDEVA
Download sequence
Identical sequences A0A1X6MUI3
jgi|Pospl1|43699|e_gw1.1.362.1 104341.JGI43699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]