SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI51033 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI51033
Domain Number 1 Region: 48-101
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000129
Family ZZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI51033
Sequence length 111
Comment (Postia placenta MAD 698)
Sequence
FHVFFKFPRPLNRPLQVGRPLVPKLYKYPAGPPDGNYDMSNPKAYLAGLVHSFALCDRCM
TRINGEWYRCGYCSIDLCEVCHRMDTHNDRHAFVVFKSPVRRSLFACLIVA
Download sequence
Identical sequences jgi|Pospl1|51033|e_gw1.5.161.1 104341.JGI51033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]