SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI51289 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI51289
Domain Number 1 Region: 657-705
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000129
Family ZZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 13-90
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000193
Family PB1 domain 0.0091
Further Details:      
 
Domain Number 3 Region: 441-506
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0000196
Family Zn-finger domain of Sec23/24 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI51289
Sequence length 750
Comment (Postia placenta MAD 698)
Sequence
MSYSDYSVSDHNRSETRPDKALVVKCAYDEAVRKITFSSTRTCSYELLRQRIEEGFSLYT
TPFAITYTDDDGEVTDIATDADLTEAIRYVYPVNDDPPLSSSSSILSGRSLTRGKITLRV
RITVEYDGPSLSDTSSLVSLEEYRNRNGSELSLSLSMPPAGEIEDDSITVSSKDMGSKHD
MYRARGPKTMVSGPSRETLRNDAHEPTVEEEKWEGATMSSVPPTMAVDKLSSSHSYAPSS
EQDPFSDKQAALDPTSVFERLRLEEDLQSRQPGSSYGSSTLHSERGAAWLRDQNARTIKG
MLGELPAPSEKSYEPSVAAPEDTGSVLSGELALQQDATGKYYYAYTAGSSSYGASQSVPD
SGFEDVSDVHRASITANPALSRPTSMEVNGYDYQEVSGNALHRSSSSASNPFIRRSMSEP
IFPPDYIDPDVPPEVLQFITGIPPIPPENPPTCSNCRTIMDTFRYVCSTCGEQKPISPSE
LYGMDNGKGKTRAVEMEFTNGKYSFPPSPPTMSSASSTSSWSMVSSSNAPLRNTSDATLS
AGPRSLKPLPAVPMKSNGSSSSTLTISTPYSPYDTASTGYELCWQCLPTAGVTHALEMSV
APGSSPSLAEWPSSEDAQRAMSQWRRTAPSQKGQLRHAYIEKSWGHKGWQDVEQDDHRSC
TCSTCGTQIVNHRYKCASCENFNLCKACYSQVHEIHPSHAFLVVPDKLPRSRSEPHNMMS
AYGEACMSFCWQYLYTSLTRFFTKPSNIQG
Download sequence
Identical sequences jgi|Pospl1|51289|e_gw1.5.32.1 104341.JGI51289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]