SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI52167 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI52167
Domain Number 1 Region: 184-236
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000121
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 2 Region: 31-115
Classification Level Classification E-value
Superfamily RING/U-box 0.000000153
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Weak hits

Sequence:  104341.JGI52167
Domain Number - Region: 121-176
Classification Level Classification E-value
Superfamily RING/U-box 0.018
Family IBR domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI52167
Sequence length 278
Comment (Postia placenta MAD 698)
Sequence
DAELVKEMEWVQLRLQEEPSAQAADQGEEDEENSIECGCCFSIYPFEKMIQCPEAHLFCT
DCIISYASTLLGSHDARIACMDQSGCKELFPESELRRVLPPKLVGLYDRVCQRRDIEAAG
LENLEECPFCEYKCVIDNPQEKLFRCENADCMAVTCRECKKADHLPRSCKEVEEDKKLDV
RHAIEEAMTRALMRNCPKCSKAFIKEQGCNKMTCPNCATMSCYICRKVVTGYYHFSNVSA
YRLILDSPAYMYSLPASPVHRTSKSKKVPVMGSRRAAT
Download sequence
Identical sequences jgi|Pospl1|52167|e_gw1.15.99.1 104341.JGI52167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]