SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI57787 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI57787
Domain Number 1 Region: 184-263,511-673
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.04e-50
Family Tandem AAA-ATPase domain 0.00028
Further Details:      
 
Domain Number 2 Region: 2-31,74-175
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.93e-22
Family Tandem AAA-ATPase domain 0.0008
Further Details:      
 
Domain Number 3 Region: 306-377
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000505
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI57787
Sequence length 694
Comment (Postia placenta MAD 698)
Sequence
IVFTGPNKPKKKEDLMQYDIVLTTYQTLALEWPDDEAEEREAKRKAKKKRTSDNFIESVS
EDEKSKKKKKKQELGLLFQVEWYRVVLDEAQNIRNKRTRSSRAVTKLESNYRWCLTGTPI
INGLSDAYGLLRFLRIRPWYDWNDFNSHISRFERKQPIVATSRLQAIFATMLLRRKKDSM
LDGKRLIELPLKEVILTKLTFTLEERDIYKMVELKSQAIFNRFLKAGTVLKNYHQVLVLL
LRLRQVCSHPCLIQEHNAAFIAAADLNDGNHDKRYELSRARQLVSDEFVESIQTKMKIII
LQRIEAEKESPDATIDDEECPICYDTFTDPVVTPCAHIFCRECISTCPITPKNQYADSSA
DNSDERPCPACRGVLVKHKLFSRSAFEPSDKDLGTADGAGGSTDGDASAVLADDCAEAEH
PKPGSTFRKRKLQKKCAYDSDEEEEEGDDDLNDFIVEDDEDEEEKDACLALRKRLGKRRA
IILSDDEMDIDDDVICGAKPDAEIPPEQVKLMPRFLPSTKMKHMMESLKAWAKSNPDEKT
LVISQWTQCLQLVSDYLTENGFLHVKYQGDMNRRKRDQAIRVFMAKDKATIMLMSLKCGG
VGLNLTRANRVISLDLGWSEAVESQAFDRVHRLGQTRPVYVHRLVIADTVEDRVLALQER
KKNLADGSLGEGNGKKLGRAFSMIIGYADCLMSS
Download sequence
Identical sequences 104341.JGI57787 jgi|Pospl1|57787|e_gw1.17.22.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]