SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI91254 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI91254
Domain Number 1 Region: 319-359
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000083
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 2 Region: 192-245
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000546
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI91254
Sequence length 385
Comment (Postia placenta MAD 698)
Sequence
MAGAVTSTLLRPYLHILSYLGLEVLSLRARVLDIESQNGYLTADNERLSGEVSRLEDEVA
ELKAQSQTQIFVQDKSYRNVSRTFDVARDSQSQKGKGREVYVPHTSTNEVDSKQFIPPRR
QIEGSHASSSRRAGSAFYDPMYDHDFALAAALQAEQMPSQDGAYAASMQREFDGEDARLK
AQMTTLKHTAPGIFECGICLEEFNVDVVARIDICGHQFCRTCILGHTAAKIDERRYPIVC
PICMADKGLKKQGDKQYEVFVEMQLAAFSVILHCRKCKNTVFVDKSEHAATEILKIEFGG
PKHSCDGSSELKHLMQQRGWKYCPGCKTPAEKIDGCNHMTCMSPGCNTHFCYVCGEAITQ
SALRSEIKSALSAHYRRCRLFEDVA
Download sequence
Identical sequences B8PP11
XP_002477417.1.31404 jgi|Pospl1|91254|fgenesh3_pg.558__1 104341.JGI91254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]