SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI92910 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI92910
Domain Number - Region: 84-117
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000262
Family FHA domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI92910
Sequence length 669
Comment (Postia placenta MAD 698)
Sequence
MTRAPCYERRANAIWAMPAVARVVSTVDDCRVNNQRNTTRNDRLGRIRASSGQPADSELS
VAHPPWMHHARARGSTLADPPVPQLFIKDVKSSNGTFINGERPRPEGAESEPFELKSWCE
FGIDIVGEDNKTIIHHKIAARVAQAGPTAYGVGALPAAGKFSFAPVQLPNAPGQQRRPSF
QQGLIGLGDRGRNMNVPGKSGLTLDHILSRLQGELQKSRNTGAELHSLTSAMNEIHDTLG
GNLLPNLPPHPSNLPPVMPPQSQQQQEESEQQQAPQAPSPSDSDKIRSLETMLAEHEAIK
REVGSLRELMEECKREMDTSRGRSGSPSGRRQYGHDDDSHYMSDDDDNVHSVSTIVPHEL
DRVDEEDEEQLATEEKRSSGGGGGKSWVARACQSQRERVQVQTEATEQLAEAMCSEQPPD
SAAQEAEQRTRESLTEMVNEWKKNEEWTEEREDLRRAKDEWETRIRVVEDGVGSNISKVE
SMLGTLAALPAQQHSFLNGNGKLTHSGGLVTPPSPRSLSAESTRPRQRRKRSSSSRGRSR
SRSASMAAGVECLPWTADDSSISDTESHAASDRATAAGEDEPTRSLKGMPFPITPEFSVL
NHPLSSSDDASGTATDSQTQPPPKDLSHFNLSAAFRYLFVWIPLHRFRTAELLVMPFLCQ
MGSIGPVPF
Download sequence
Identical sequences B8PE80
104341.JGI92910 jgi|Pospl1|92910|fgenesh3_pg.99__6 XP_002474002.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]