SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 107806.BU373 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  107806.BU373
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-49
Family Ribonuclease PH domain 1-like 0.0000169
Further Details:      
 
Domain Number 2 Region: 296-468
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-48
Family Ribonuclease PH domain 1-like 0.0000252
Further Details:      
 
Domain Number 3 Region: 450-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.22e-26
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 145-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.68e-24
Family Ribonuclease PH domain 2-like 0.0021
Further Details:      
 
Domain Number 5 Region: 609-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-21
Family Cold shock DNA-binding domain-like 0.0000898
Further Details:      
 
Domain Number 6 Region: 230-325
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.92e-21
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0024
Further Details:      
 
Domain Number 7 Region: 554-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000167
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 107806.BU373
Sequence length 707
Comment (Buchnera sp)
Sequence
MLNPIVRKFQYGQHTITLETGVIARQANAAVMASMDETAVFVTVVGQKKIHTGQKFFPLT
VNYQERTYAAGRIPGGFFRREGRPSENEILTARLIDRPLRPLFPKKFLNEIQIIATVVSV
NPQINPDIISIIGASAALSLSGIPFYGPVGAARVGYINNQYILNPISDDMKNSSLDLVVS
GTQNAILMVEAESKILSEEKILGAIIFGHQQQQVVINNIRSLSNEASKLPWVISYPETNK
TLELKIINSFEKNISDAYVIFNKQDRIEKLNSIKENIIKLFLDENSNIDTLEIEDIFQKI
EKKVVRKRILSNQTRIDGREKDMIRALDVRTGILPRTHGSALFTRGETQSLVSVTLGTSR
DAQNLDELLGDRIDNFLFHYNFPPYSVGEIGMVGSPKRREIGHGRLAKRSLLAVMPTLEN
FPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPIKSAVAGISMGLVKEGNQHVLLSD
ILGDEDHLGDMDFKVAGTEEGITALQMDMKIEGITNEIIHSALNEARLARLHILNVMNQA
LNESRSEISEFAPRIHIIKINPEKIKDVIGKGGSVIRMLTEETGTIIEIEDDGTVKISST
VKEKAKNAIRRIKEITAEIEVGRIYSGKVTRIVDFGAFVSIGLGKEGLVHISQISDKRVD
KVSNHLKIDQIISVKVLEIDRQGRLRLSIKEIDSSILSNKSINNSII
Download sequence
Identical sequences A0A1W9SRC1 B8D7R0 B8D9F8 P57454
gi|384226176|ref|YP_005617339.1| gi|219681731|ref|YP_002468117.1| gi|414562733|ref|YP_005617924.1| gi|219682286|ref|YP_002468670.1| 107806.BU373 561501.BUAPTUC7_367 563178.BUAP5A_366 NP_240191.1.37072 WP_009874331.1.11339 WP_009874331.1.46144 WP_009874331.1.52070 WP_009874331.1.6230 WP_009874331.1.93284 WP_009874331.1.93731 gi|384227234|ref|YP_005618984.1| gi|15616978|ref|NP_240191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]