SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1140.Synpcc7942_0042 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1140.Synpcc7942_0042
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily L28p-like 1.35e-26
Family Ribosomal protein L28 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1140.Synpcc7942_0042
Sequence length 78
Comment (Synechococcus elongatus PCC 7942)
Sequence
MSRVCQLTGKKANNAYAISHSHRRTKRLQNVNLQEKRIWWPEGNRFVKLRLSTKAIKTLQ
KKGLSAYARELGIDLKRL
Download sequence
Identical sequences Q31S95 Q5N223
gi|81298853|ref|YP_399061.1| 1140.Synpcc7942_0042 269084.syc1457_d WP_011243767.1.45845 WP_011243767.1.5740 WP_011243767.1.95485 gi|56751466|ref|YP_172167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]